General Information

  • ID:  hor005318
  • Uniprot ID:  P12969
  • Protein name:  Islet amyloid polypeptide
  • Gene name:  Iapp
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  Abundant in the islets of Langerhans but is not present in the brain or seven other tissues examined.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0008289 lipid binding; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0006006 glucose metabolic process; GO:0010739 positive regulation of protein kinase A signaling; GO:0019233 sensory perception of pain; GO:0030316 osteoclast differentiation; GO:0042755 eating behavior; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045453 bone resorption; GO:0045671 negative regulation of osteoclast differentiation; GO:0045779 negative regulation of bone resorption; GO:0050850 positive regulation of calcium-mediated signaling; GO:0097647 amylin receptor signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0043025 neuronal cell body

Sequence Information

  • Sequence:  KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
  • Length:  37
  • Propeptide:  MRCISRLPAVLLILSVALGHLRATPVGSGTNPQVDKRKCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTYGKRNVAEDPNRESLDFLLL
  • Signal peptide:  MRCISRLPAVLLILSVALGHLRA
  • Modification:  T37 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  Calcr
  • Target Unid:  P32214
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  2kj7(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    2kj7.pdbhor005318_AF2.pdbhor005318_ESM.pdb

Physical Information

Mass: 456573 Formula: C167H273N51O54S2
Absent amino acids: DEHIMW Common amino acids: N
pI: 9.54 Basic residues: 3
Polar residues: 19 Hydrophobic residues: 11
Hydrophobicity: -24.86 Boman Index: -5931
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 73.78
Instability Index: 2538.11 Extinction Coefficient cystines: 1615
Absorbance 280nm: 44.86

Literature

  • PubMed ID:  2679555
  • Title:  Isolation and sequence determination of rat islet amyloid polypeptide.
  • PubMed ID:  2357234
  • Title:   Sequence divergence in a specific region of islet amyloid polypeptide (IAPP) explains differences in islet amyloid formation between species.